PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004503684.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family TALE
Protein Properties Length: 604aa    MW: 68727.4 Da    PI: 6.8184
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004503684.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.4e-093794161954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  XP_004503684.1 379 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 416
                     664459******************************88 PP

2BELL115.42.8e-37241311272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     + elqk+k+kLls+leeVd+rYk+y +q++ v+ sFeavag g+ak+Y +lAlka+SrhFrcLkd i eqi
  XP_004503684.1 241 FVELQKRKTKLLSMLEEVDRRYKHYSNQMKSVVCSFEAVAGNGAAKVYSALALKAMSRHFRCLKDGILEQI 311
                     679*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.3E-54171309IPR006563POX domain
PfamPF075262.5E-47176307IPR006563POX domain
PROSITE profilePS5007112.05357420IPR001356Homeobox domain
SMARTSM003897.0E-9360424IPR001356Homeobox domain
CDDcd000862.09E-11360421No hitNo description
SuperFamilySSF466893.64E-17361426IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-28363426IPR009057Homeodomain-like
PfamPF059208.0E-18377416IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MARQLCEDDN KTSSHGFIYP TIQTQIQGFV SDPEMFNLTT GMEMIGFSKH HHLQHLVPSS  60
SSKTMNDSSS NNNFYHHHHH HQQQQQDFTS ETTSSENLNM WQENRSLLVD DSSLRCVFPC  120
EGNERPSQGL SLSLSSTNPS TIGLQSFELR QNSHNNNHHQ QQQQMTTTNM YSGHFVLKNS  180
KFLAPAQELL NEFCSLGTTK QNDVGLVQKQ KSQKYKQGWE EDNNNGSSSS SIKHSLTSIE  240
FVELQKRKTK LLSMLEEVDR RYKHYSNQMK SVVCSFEAVA GNGAAKVYSA LALKAMSRHF  300
RCLKDGILEQ IETTRKAMGE KDPVAPGTTK GETPRLKILD RVLRQQRAFQ QINMMETHPW  360
RPQRGLPERS VSILRAWLFE HFLHPYPSDV DKHILARQTG LSRSQVSNWF INARVRLWKP  420
MVEEMYLEEE KEQQRKTTTS EGGNNEENIN VIQNQSPTQA HEDEKPRLVR INSECVSSII  480
NNQDHKNEAN KNMNPQLAND TFGSVDIDFS SYHSSDMVAA YTTSDHNHNF HGGSGVSLTL  540
GLQQHGGNGV SLAFPSTTQT PMFYTRDDDH IEEPVQYSLL DGDQGTNIMP YRNLMGTQLL  600
HDLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15366424563Homeobox protein Meis2
3k2a_B1e-15366424563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004503684.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-135BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A072TUA60.0A0A072TUA6_MEDTR; BEL1-related homeotic protein
STRINGGLYMA11G02450.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-118TALE family protein